PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla008610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family YABBY
Protein Properties Length: 170aa    MW: 18743.2 Da    PI: 8.9262
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla008610genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY209.51.2e-6461565160
      YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsen 104
                 +se+vCyv+CnfCntilavsvP +s+f++vtvrCGhC++llsvn+  + q+++ ++  ++  k+++++   ++++  +s  ++++s+ t++ s  l ++
  Cla008610   6 MASERVCYVHCNFCNTILAVSVPCNSMFTLVTVRCGHCSNLLSVNMGASLQVVPPQDS-QQGHKQQQVNAGDSSKDRASSSSSSSSSKCTKIGS--L-DS 101
                689***************************************************9997.33333333333333333333333333333333333..3.34 PP

      YABBY 105 edeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknW 160
                 +++  r+pp irPPekrqrvPsaynrfikeeiqrika+nPdishreafs+aakn 
  Cla008610 102 AERDQHRIPP-IRPPEKRQRVPSAYNRFIKEEIQRIKAKNPDISHREAFSTAAKNM 156
                4555666677.9******************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.2E-667156IPR006780YABBY protein
SuperFamilySSF470958.64E-7111153IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.109.5E-4120151IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MSLDMMASER VCYVHCNFCN TILAVSVPCN SMFTLVTVRC GHCSNLLSVN MGASLQVVPP  60
QDSQQGHKQQ QVNAGDSSKD RASSSSSSSS SKCTKIGSLD SAERDQHRIP PIRPPEKRQR  120
VPSAYNRFIK EEIQRIKAKN PDISHREAFS TAAKNMDTNS SLLQSITDRV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818421e-50LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022.
GenBankLN7132591e-50LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008449608.16e-95PREDICTED: putative axial regulator YABBY 2
SwissprotQ9XFB07e-60YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLA0A0A0KGY12e-94A0A0A0KGY1_CUCSA; Uncharacterized protein
STRINGVIT_06s0009g00880.t011e-74(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.16e-58YABBY family protein